What is CJC-1295? With and without DAC
Two related synthetic analogues of the first 29 amino acids of GHRH. The name CJC-1295 is used for both. What the difference is, and how to tell them apart.
- Purity
- ≥99% HPLC
- COA
- per batch
- Strength
- 5 mg
CJC-1295 DAC
CJC-1295 DAC is a synthetic peptide of 30 amino acids, a modified GHRH(1-29) chain with an extra lysine that carries the DAC group. Buy CJC-1295 DAC for laboratory research from PulseChem: 5 mg of lyophilized powder per vial, ≥99% purity by HPLC and a COA for every batch.
€57.45 incl. VAT · €47.48 excl. VAT
- Shipping from Europe
- 1–3 working days within Europe
In stock
Volume discount
- 1–4 unitsUnit price€57.45 per unit
- 5–9 units5% off€54.58 per unit
- 10+ units10% off€51.71 per unit
Research Use Only. For laboratory research use only (in vitro). Not for human or animal use. The products are not medicines, foods, or cosmetics. They are not intended to diagnose, treat, cure, or prevent any disease. The information on this website has not been evaluated by the EMA, the Romanian National Agency for Medicines and Medical Devices (ANMDMR), or the FDA. Read the RUO policy
How is a solution prepared?
This is how solutions are prepared in the lab.
Step 1 of 8: Disinfect
The stoppers of both vials are wiped with an alcohol swab.
- Disinfect. The stoppers of both vials are wiped with an alcohol swab.
- Draw up. The needle passes through the stopper of the bacteriostatic water and the plunger draws up liquid.
- Transfer. The liquid runs down the inside wall of the vial with powder.
- Mix. The vial is gently swirled until the solution is clear.
- Done. The solution is ready for use in research.
- Take sample. A new needle passes through the stopper and the plunger draws up part of the solution.
- Sample vial. The solution runs through the septum of the screw cap into a sample vial.
- Analyze. The sample vial goes into the autosampler; the instrument measures the solution in vitro.
For laboratory research use only (in vitro). Not for human or animal use.
Molecule
Research area: Brain
- Molecular formula
- C165H269N47O46
- Molecular mass
- 3,647.2 g/mol
Sequence: H-Y[D-Ala]DAIFTQSYRKVLAQLSARKLLQDILSRK-NH₂
- first residue (N-terminus)
- modified residue or group
Structure from PubChem, CID 91971820. Schematic in 3D, not a measured structure.
The chain of CJC-1295 DAC
Schematic view of the chain. This is not a measured 3D structure.
Point to an amino acid or use the arrow keys to see its name.
Drag or use the arrow keys to rotate the diagram. Point to a bead to see the name of the amino acid.
- Hydrophobic
- Uncharged side chain that avoids water.
- Polar
- Uncharged side chain that binds water.
- Positively charged
- Basic side chain, positive at neutral pH.
- Negatively charged
- Acidic side chain, negative at neutral pH.
The chain has 30 amino acids, shown here from the N-terminus to the C-terminus. The C-terminus is an amide, 1 building block is in the D-form, and the side chain of Lys at position 30 carries MPA.
On the research map: Brain and pituitary
Batch and COA
The batch number is on the vial label. You can find the certificate of analysis for that batch on the Lab results page or request it from us.
Specifications
| Contents | 5 mg per vial |
|---|---|
| Sequence | H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(MPA)-NH2 |
| Purity | ≥99% (HPLC) |
| Intended use | For laboratory research use only (RUO) |
About CJC-1295 DAC
Buy CJC-1295 DAC from PulseChem
Each sealed glass vial holds 5 mg of CJC-1295 DAC as a lyophilized (freeze-dried) powder. The label shows the strength and the batch number, also printed on the certificate of analysis.
If you are looking for CJC-1295 with DAC for sale, this is the product; the form without DAC comes in the blend CJC-1295 (no DAC) + Ipamorelin. Anyone aged 18 or over who buys for laboratory research can order, as a guest or with an account, and confirms research use at checkout.
What is CJC-1295 DAC?
CJC-1295 DAC is a synthetic analog of GHRH(1-29). Four building blocks of that chain have been replaced, and an extra lysine sits at the end. The side chain of that lysine carries a maleimidopropionyl group: the Drug Affinity Complex, or DAC.
Jetté and colleagues at ConjuChem described CJC-1295 in 2005 in the journal Endocrinology. CJC-1295 is not authorized as a medicine. Both forms are covered in What is CJC-1295? With and without DAC.
Purity and COA for every batch
An external laboratory tests every batch: HPLC for purity (≥99%) and mass spectrometry for identity. For this product the mass settles it: the form with DAC is almost 280 g/mol heavier than the form without, so the COA shows which of the two a batch contains. Find the COA for your batch number under Lab results.
Storage and shipping
Keep the vial closed, cool, dry and dark, as the label and COA state. We ship from Europe in insulated packaging with track and trace, adding a cold pack in warm weather. Orders received and paid before 3 p.m. Central European time on a working day leave the same day; delivery takes 1–3 working days within Europe. EU only.
For laboratory research only, not for human or animal use.
Questions about CJC-1295 DAC
Where can I buy CJC-1295 DAC?
CJC-1295 DAC is available from PulseChem in this web shop. A 5 mg vial costs €57.45 including VAT, and CJC-1295 DAC is in stock. Orders received and paid before 3 p.m. Central European time on a working day ship the same day; delivery takes 1–3 working days within Europe. Every batch has its own COA.
What is in a vial of CJC-1295 DAC?
A vial of CJC-1295 DAC contains 5 mg of lyophilized (freeze-dried) powder in sealed glass. The label shows the strength and the batch number. With that number you can find the certificate of analysis for exactly that batch under Lab results, including purity and measured mass.
How is the purity of CJC-1295 DAC tested?
An external laboratory measures the purity of CJC-1295 DAC for every batch by HPLC: ≥99%. Mass spectrometry confirms the identity. With electrospray ionization, a peptide of this length with several arginines and lysines shows up as a series of peaks with different charge states. Both measurements are on the COA for the batch.
What is the difference between CJC-1295 with and without DAC?
CJC-1295 with DAC has the same 29-amino-acid chain as the form without DAC, plus an extra lysine carrying a maleimidopropionyl group. That makes the form with DAC almost 280 g/mol heavier. At PulseChem, CJC-1295 DAC is a product of its own; the form without DAC comes in a blend with ipamorelin. See What is CJC-1295? With and without DAC.
Background from the knowledge base
What are peptides?
A peptide is a short chain of amino acids joined by peptide bonds. How peptides differ from proteins, which peptides occur in nature, and which items in the catalog are not peptides.
How to read a mass spectrum
A mass spectrum on a certificate of analysis shows m/z, not mass. On ionisation, charge states, monoisotopic and average mass, and peaks that do not belong to the peptide.
