What is a COA?
A certificate of analysis tells you what is in a batch and how it was measured. How to read one, and how to check that it belongs to your vial.
- Purity
- ≥99% HPLC
- COA
- per batch
- Strength
- 5 mg
LL-37
LL-37 is a synthetic peptide of 37 amino acids, the C-terminal part of the human protein hCAP18 from the cathelicidin family. Buy LL-37 for laboratory research from PulseChem: 5 mg of lyophilized powder per vial, ≥99% purity by HPLC and a COA for every batch.
€54.45 incl. VAT · €45.00 excl. VAT
- Shipping from Europe
- 1–3 working days within Europe
In stock
Volume discount
- 1–4 unitsUnit price€54.45 per unit
- 5–9 units5% off€51.73 per unit
- 10+ units10% off€49.01 per unit
Research Use Only. For laboratory research use only (in vitro). Not for human or animal use. The products are not medicines, foods, or cosmetics. They are not intended to diagnose, treat, cure, or prevent any disease. The information on this website has not been evaluated by the EMA, the Romanian National Agency for Medicines and Medical Devices (ANMDMR), or the FDA. Read the RUO policy
How is a solution prepared?
This is how solutions are prepared in the lab.
Step 1 of 8: Disinfect
The stoppers of both vials are wiped with an alcohol swab.
- Disinfect. The stoppers of both vials are wiped with an alcohol swab.
- Draw up. The needle passes through the stopper of the bacteriostatic water and the plunger draws up liquid.
- Transfer. The liquid runs down the inside wall of the vial with powder.
- Mix. The vial is gently swirled until the solution is clear.
- Done. The solution is ready for use in research.
- Take sample. A new needle passes through the stopper and the plunger draws up part of the solution.
- Sample vial. The solution runs through the septum of the screw cap into a sample vial.
- Analyze. The sample vial goes into the autosampler; the instrument measures the solution in vitro.
For laboratory research use only (in vitro). Not for human or animal use.
Molecule
Research area: Immune
- Molecular formula
- C205H340N60O53
- Molecular mass
- 4,493 g/mol
Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
- first residue (N-terminus)
Structure from PubChem, CID 16198951. Schematic in 3D, not a measured structure.
The chain of LL-37
Schematic view of the chain. This is not a measured 3D structure.
Point to an amino acid or use the arrow keys to see its name.
Drag or use the arrow keys to rotate the diagram. Point to a bead to see the name of the amino acid.
- Hydrophobic
- Uncharged side chain that avoids water.
- Polar
- Uncharged side chain that binds water.
- Positively charged
- Basic side chain, positive at neutral pH.
- Negatively charged
- Acidic side chain, negative at neutral pH.
- Special (Gly, Pro, Cys)
- Help determine the shape of the chain; cysteine can form a bridge.
The chain has 37 amino acids, shown here from the N-terminus to the C-terminus. Calculated average molecular mass: 4,493.3 g/mol. Compare this figure with the mass on the certificate of analysis.
On the research map: Immune system
Batch and COA
The batch number is on the vial label. You can find the certificate of analysis for that batch on the Lab results page or request it from us.
Specifications
| Contents | 5 mg per vial |
|---|---|
| Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
| Purity | ≥99% (HPLC) |
| Intended use | For laboratory research use only (RUO) |
About LL-37
Buy LL-37 from PulseChem
A sealed glass vial of LL-37 contains 5 mg of lyophilized (freeze-dried) powder. The batch number appears on the label and on the matching COA.
With LL-37 for sale to guests and account holders alike, anyone aged 18 or over who is buying for laboratory research can order. You confirm research use at checkout.
What is LL-37?
LL-37 belongs to the cathelicidins, a protein family. The human CAMP gene encodes the precursor protein hCAP18 (UniProt P49913), and LL-37 is its last stretch on the C-terminal side. In 1996, Gudmundsson and colleagues described in the European Journal of Biochemistry how hCAP18 is cleaved into LL-37. The name says what it is: 37 amino acids, starting with two leucines. LL-37 is not authorized as a medicine.
Purity and COA for every batch
An external laboratory measures purity by HPLC (≥99%) and identity by mass spectrometry. A peptide of this length picks up several protons in electrospray and gives a series of peaks with different charges, which together calculate back to one mass. The checks are described in the Laboratory standard; the COA is on Lab results.
Storage and shipping
Store LL-37 closed, cool, dry and dark, following the label and COA. The parcel ships from Europe insulated and with tracking, plus a cold pack in warm weather. Orders paid and received before 3 p.m. Central European time on a working day ship that day; delivery takes 1–3 working days within Europe. EU only.
For laboratory research only, not for human or animal use.
Questions about LL-37
Where can I buy LL-37?
LL-37 is available from PulseChem in this web shop. The 5 mg vial costs €54.45 including VAT, and LL-37 is in stock. Orders received and paid before 3 p.m. Central European time on a working day ship the same day; delivery takes 1–3 working days within Europe. Every batch has its COA.
What is in a vial of LL-37?
A vial of LL-37 contains 5 mg of lyophilized (freeze-dried) powder, sealed in glass. The label states the amount and the batch number. With that number you find the COA of that exact batch on the Lab results page.
Is LL-37 a medicine?
No, LL-37 is not authorized as a medicine. The LL-37 sold by PulseChem is a research chemical: a synthetic peptide sold for laboratory research only, not for human or animal use. You also confirm this at checkout.
Where does the name LL-37 come from?
The name LL-37 describes the peptide itself: the chain has 37 amino acids and starts with two leucines, L in the one-letter code. That is also how PubChem shows the sequence. Gudmundsson and colleagues used the name LL-37 in 1996 in the European Journal of Biochemistry for the peptide from hCAP18.
Background from the knowledge base
What does 99% purity mean?
A purity of 99% tells you about the composition of the peptide, not about the amount in the vial. What the number measures, and what it does not.
Why lyophilize?
Peptides are supplied as a freeze-dried powder because they break down quickly in solution. What happens during freeze-drying, and what it means for storage.
