What is CJC-1295? With and without DAC
Two related synthetic analogues of the first 29 amino acids of GHRH. The name CJC-1295 is used for both. What the difference is, and how to tell them apart.
- Purity
- ≥99% HPLC
- COA
- per batch
- Strength
- 5 mg + 5 mg
CJC-1295 (no DAC) + Ipamorelin
CJC-1295 (no DAC) + Ipamorelin is a fixed combination of the peptides CJC-1295 without DAC and ipamorelin, 5 mg each in one vial. Buy CJC-1295 no DAC + Ipamorelin for laboratory research from PulseChem: lyophilized powder, ≥99% purity by HPLC and a COA for every batch.
€72.45 incl. VAT · €59.88 excl. VAT
- Shipping from Europe
- 1–3 working days within Europe
In stock
Volume discount
- 1–4 unitsUnit price€72.45 per unit
- 5–9 units5% off€68.83 per unit
- 10+ units10% off€65.21 per unit
Research Use Only. For laboratory research use only (in vitro). Not for human or animal use. The products are not medicines, foods, or cosmetics. They are not intended to diagnose, treat, cure, or prevent any disease. The information on this website has not been evaluated by the EMA, the Romanian National Agency for Medicines and Medical Devices (ANMDMR), or the FDA. Read the RUO policy
How is a solution prepared?
This is how solutions are prepared in the lab.
Step 1 of 8: Disinfect
The stoppers of both vials are wiped with an alcohol swab.
- Disinfect. The stoppers of both vials are wiped with an alcohol swab.
- Draw up. The needle passes through the stopper of the bacteriostatic water and the plunger draws up liquid.
- Transfer. The liquid runs down the inside wall of the vial with powder.
- Mix. The vial is gently swirled until the solution is clear.
- Done. The solution is ready for use in research.
- Take sample. A new needle passes through the stopper and the plunger draws up part of the solution.
- Sample vial. The solution runs through the septum of the screw cap into a sample vial.
- Analyze. The sample vial goes into the autosampler; the instrument measures the solution in vitro.
For laboratory research use only (in vitro). Not for human or animal use.
Molecule
Research area: Brain
CJC-1295 (no DAC) · 29 amino acids
Sequence: H-Y[D-Ala]DAIFTQSYRKVLAQLSARKLLQDILSR-NH₂
Ipamorelin · 5 amino acids
Sequence: H-[Aib]H[D-2Nal][D-Phe]K-NH₂
- first residue (N-terminus)
- modified residue or group
Structure from PubChem, CID 56841945, 9831659. Schematic in 3D, not a measured structure.
Batch and COA
The batch number is on the vial label. You can find the certificate of analysis for that batch on the Lab results page or request it from us.
Specifications
| Contents | 5 mg + 5 mg per vial |
|---|---|
| Purity | ≥99% (HPLC) |
| Intended use | For laboratory research use only (RUO) |
About CJC-1295 (no DAC) + Ipamorelin
Buy CJC-1295 no DAC + Ipamorelin from PulseChem
Each sealed glass vial contains 5 mg of CJC-1295 without DAC and 5 mg of ipamorelin, freeze-dried together into one lyophilized powder. The strength itself states the split. The label shows that strength and a single batch number for the whole vial.
Looking for a CJC-1295 Ipamorelin blend for sale? Anyone 18 or older who buys for laboratory research can order this one, as a guest or with an account; research use is confirmed at checkout.
Composition of the blend
CJC-1295 without DAC is a chain of 29 amino acids, derived from GHRH(1-29) with four building blocks replaced; it is also sold as Mod GRF 1-29. Ipamorelin is a pentapeptide with three non-standard building blocks. Raun and colleagues at Novo Nordisk described it in 1998 in the European Journal of Endocrinology.
Neither compound is authorized as a medicine. How the label and COA of a blend are put together is explained in Peptide blends: reading the label and the COA.
Purity and COA for every batch
An external laboratory measures purity by HPLC (≥99%) and identity by mass spectrometry. In a blend each component gives its own signal; CJC-1295 without DAC is almost five times as heavy as ipamorelin, so the two sit clearly apart in the mass spectrum. The COA for the batch number is under Lab results.
Storage and shipping
Keep the vial closed, cool, dry and dark per the label and COA; in a blend, the most sensitive component sets the rule. It ships from Europe, insulated and tracked, with a cold pack in warm weather. Received and paid before 3 p.m. Central European time on a working day: shipped the same day. Delivery takes 1–3 working days within Europe, to EU addresses only.
For laboratory research only, not for human or animal use.
Questions about CJC-1295 (no DAC) + Ipamorelin
Where can I buy CJC-1295 no DAC + Ipamorelin?
CJC-1295 (no DAC) + Ipamorelin is available from PulseChem in this web shop. The 5 mg + 5 mg vial costs €72.45 including VAT, and CJC-1295 (no DAC) + Ipamorelin is in stock. An order received and paid before 3 p.m. Central European time on a working day is shipped the same day; delivery takes 1–3 working days within Europe. Each batch comes with a COA.
What is in a vial of CJC-1295 (no DAC) + Ipamorelin?
A vial of CJC-1295 (no DAC) + Ipamorelin contains 5 mg of CJC-1295 without DAC and 5 mg of ipamorelin, together as a lyophilized powder in sealed glass. The label carries one batch number. Use that number to find the COA for the batch under Lab results.
Who can order CJC-1295 (no DAC) + Ipamorelin?
CJC-1295 (no DAC) + Ipamorelin can be ordered by anyone aged 18 or over who buys for laboratory research. You do not need an account: order as a guest or sign in. At checkout you confirm that the product is for laboratory research only. Peptide blends for sale at PulseChem are otherwise ordered the same way as single peptides.
What is the difference from CJC-1295 DAC?
CJC-1295 (no DAC) + Ipamorelin contains the form of CJC-1295 without the DAC group: the 29-amino-acid chain without the extra lysine and its maleimidopropionyl group. That form shares one vial with ipamorelin, 5 mg each. At PulseChem, CJC-1295 DAC is a separate 5 mg vial. See What is CJC-1295? With and without DAC.
Background from the knowledge base
What is ipamorelin?
Ipamorelin is a synthetic five-residue peptide described as a selective agonist of the ghrelin receptor. Structure, its origin at Novo Nordisk, and its status.
Peptide blends: reading the label and the COA
A blend is one vial holding two or more compounds in a fixed ratio. How the label states the amount, how such a mixture is measured, and what belongs on its certificate.
